Brevibacillus formosus: BP422_07495 Help Entry BP422_07495       CDS       T04939                                  Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism bfm  Brevibacillus formosus Brite KEGG Orthology (KO) [BR:bfm00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:bfm03032]     BP422_07495    03036 Chromosome and associated proteins [BR:bfm03036]     BP422_07495    03400 DNA repair and recombination proteins [BR:bfm03400]     BP422_07495 DNA replication proteins [BR:bfm03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     BP422_07495 Chromosome and associated proteins [BR:bfm03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     BP422_07495 DNA repair and recombination proteins [BR:bfm03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       BP422_07495 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_euk_2 DUF2267 HU-CCDC81_bac_2 HU-DNA_bdg SIS_2 Glycos_trans_3N HU-CCDC81_euk_1 Motif Other DBs NCBI-ProteinID:  ASJ53414 UniProt:  A0A0H0SSK7 LinkDB All DBs Position 1535715..1535987 Genome browser AA seq 90 aa AA seqDB search MNKTELIAKVAETTELTKKDATKAVDAVLDAIADALKTGDKVQLIGFGNFEVRERAARKG RNPQTGEEIEIASSKVPAFKPGKQLKDSIK NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaaaacagaactgattgcaaaagtggctgaaaccacagaactcaccaagaaagat gcaacgaaagcagttgatgcagttcttgacgcaattgcagatgcattgaaaactggtgat aaagtccaactgatcggctttggtaacttcgaagttcgtgaacgtgcggctcgtaaaggt cgtaacccacaaactggtgaagagatcgaaatcgcttccagcaaagtacctgcgtttaaa ccaggtaaacaactcaaagactccatcaagtag

DBGET integrated database retrieval system