Brevibacillus formosus: BP422_10025 Help Entry BP422_10025       CDS       T04939                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bfm  Brevibacillus formosus Pathway bfm00998   Biosynthesis of various antibiotics bfm01100   Metabolic pathways bfm01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bfm00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BP422_10025    00074 Mycolic acid biosynthesis     BP422_10025   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BP422_10025 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  ASJ53850 UniProt:  A0A220MH45 LinkDB All DBs Position 2221834..2222127 Genome browser AA seq 97 aa AA seqDB search MITKNEIEEKLVSIYMKQMQELQISPDNLQQSGIDFSSQEIRLQDVGINSLGFIRLVVAV ENEFGFQFEDDMLNVELFQTIQELITYIEGKVKQQSN NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgataaccaaaaacgaaatcgaagaaaaattggtgagcatctacatgaaacagatgcaa gagcttcaaattagtccggataacttgcaacaaagcgggattgatttctcgtcccaggaa atccgcttacaagatgtcggaattaactcgcttggatttattcgactggtggttgcggtt gaaaatgaatttggatttcagtttgaagatgacatgctgaatgtcgaactttttcaaacc atccaagaattgattacttatatagaggggaaagtaaagcagcaatctaattaa

DBGET integrated database retrieval system