Paraburkholderia fungorum: OI25_5222 Help Entry OI25_5222         CDS       T03799                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism bfn  Paraburkholderia fungorum Brite KEGG Orthology (KO) [BR:bfn00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bfn03036]     OI25_5222    03400 DNA repair and recombination proteins [BR:bfn03400]     OI25_5222 Chromosome and associated proteins [BR:bfn03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     OI25_5222 DNA repair and recombination proteins [BR:bfn03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       OI25_5222 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Motif Other DBs NCBI-ProteinID:  AJZ62926 UniProt:  A0AAJ3XTV1 LinkDB All DBs Position 2:complement(1392257..1392520) Genome browser AA seq 87 aa AA seqDB search MKEREEQRLFDLDGNARERLIVWIRRRMDEYGITMEALAEAIEADKAAVRAVMYRDAFGN TWDGHGDKPDWLARAIYAGQNIDHFRC NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgaaagagcgagaagaacaacggctgttcgacctcgacgggaatgcgcgtgagcgcctg atcgtgtggatccgccggcgcatggacgaatacggcataacaatggaagcgcttgccgaa gcgattgaggccgacaaagcggcagtccgcgcggtgatgtatcgcgacgccttcggtaat acttgggatggtcatggcgataaaccggactggctcgcgcgcgcgatctacgccggacag aacatcgaccatttccgttgctga

DBGET integrated database retrieval system