Bombilactobacillus folatiphilus: MOO45_02435
Help
Entry
MOO45_02435 CDS
T08484
Name
(GenBank) GlsB/YeaQ/YmgE family stress response membrane protein
Organism
bfp
Bombilactobacillus folatiphilus
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Transgly_assoc
DUF5518
Gly-zipper_Omp
Motif
Other DBs
NCBI-ProteinID:
UQS82528
UniProt:
A0ABY4P9V9
LinkDB
All DBs
Position
483586..483831
Genome browser
AA seq
81 aa
AA seq
DB search
MHWIWVLIVGALIGLLAGTLTKQNGSMGCVTNIIAGLLGSALGEWLFGFWGPQLAGMALV
PSILGAVVLVLIVSFIVAKIN
NT seq
246 nt
NT seq
+upstream
nt +downstream
nt
atgcattggatctgggttttaattgtaggcgcacttattggtttattagccggtacgtta
accaagcaaaatggttcaatgggatgtgtgacgaatatcatcgccggtttattgggatca
gctttgggtgaatggttgtttggtttttggggaccacaactagccggaatggcattagtt
ccatccattttaggagctgtcgttttggtcttgattgtgtcatttattgtagccaaaatt
aattaa
DBGET
integrated database retrieval system