Bacteroides fragilis YCH46: BF1649 Help Entry BF1649            CDS       T00202                                  Name (GenBank) conserved hypothetical protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism bfr  Bacteroides fragilis YCH46 Pathway bfr00020   Citrate cycle (TCA cycle) bfr00720   Other carbon fixation pathways bfr01100   Metabolic pathways bfr01110   Biosynthesis of secondary metabolites bfr01120   Microbial metabolism in diverse environments bfr01200   Carbon metabolism bfr01210   2-Oxocarboxylic acid metabolism Module bfr_M00009   Citrate cycle (TCA cycle, Krebs cycle) bfr_M00011   Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate Brite KEGG Orthology (KO) [BR:bfr00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     BF1649   09102 Energy metabolism    00720 Other carbon fixation pathways     BF1649 Enzymes [BR:bfr01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      BF1649 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_2 Fer4_21 Fer4_7 Fer4_6 Fer4_10 Fer4_4 Fer4_9 Fer4_16 Fer4_15 Fer4_22 Fer4_8 Fer4_17 Fer4_3 Fer4_13 DUF5651 Motif Other DBs NCBI-ProteinID:  BAD48397 UniProt:  Q64VS9 LinkDB All DBs Position complement(1914172..1914399) Genome browser AA seq 75 aa AA seqDB search MAKIKGAIVVDTERCKGCNLCVVACPLNVISLAKEVNVKGYNYAQQILEDTCNGCSSCAT VCPDGCISVYKVKVE NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggcaaaaatcaaaggagcaatcgtagtcgacacagagcgttgcaaagggtgcaacctg tgtgtggtagcttgtccgctcaacgtaatatccctcgccaaagaggtgaatgtgaaaggg tataattatgcccagcagattcttgaagatacctgtaacggatgcagttcatgcgcaacc gtatgtccggacggatgtatctctgtttataaagtaaaagtagaataa

DBGET integrated database retrieval system