Bacteroides fragilis YCH46: BF2980
Help
Entry
BF2980 CDS
T00202
Name
(GenBank) DNA polymerase III epsilon chain
KO
K02342
DNA polymerase III subunit epsilon [EC:
2.7.7.7
]
Organism
bfr
Bacteroides fragilis YCH46
Pathway
bfr03030
DNA replication
bfr03430
Mismatch repair
bfr03440
Homologous recombination
Brite
KEGG Orthology (KO) [BR:
bfr00001
]
09120 Genetic Information Processing
09124 Replication and repair
03030 DNA replication
BF2980
03430 Mismatch repair
BF2980
03440 Homologous recombination
BF2980
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03032 DNA replication proteins [BR:
bfr03032
]
BF2980
03400 DNA repair and recombination proteins [BR:
bfr03400
]
BF2980
Enzymes [BR:
bfr01000
]
2. Transferases
2.7 Transferring phosphorus-containing groups
2.7.7 Nucleotidyltransferases
2.7.7.7 DNA-directed DNA polymerase
BF2980
DNA replication proteins [BR:
bfr03032
]
Prokaryotic type
DNA Replication Elongation Factors
Elongation factors (bacterial)
DNA polymerase III holoenzyme
BF2980
DNA repair and recombination proteins [BR:
bfr03400
]
Prokaryotic type
SSBR (single strand breaks repair)
MMR (mismatch excision repair)
DNA polymerase III holoenzyme
BF2980
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
RNase_T
ExoX-like_C
RNase_H_2
DUF2095
Motif
Other DBs
NCBI-ProteinID:
BAD49728
UniProt:
Q64S03
LinkDB
All DBs
Position
complement(3385830..3386603)
Genome browser
AA seq
257 aa
AA seq
DB search
MKLNLKNPIVFFDLETTGTNINSDRIVEICYLKVYPNGNEESKTLRINPEMPIPAESSAV
HGIYDADVADCPTFKEVAKSIANDIEGCDLAGFNSNRFDIPVLAEEFLRAGVDIDMSKRK
FVDVQVIFHKMEQRTLTAAYKFYCGRNLEDAHTAEADTRATYEVLMAQLDRYPEELQNDM
SFLADYSSYNKNVDFAGRMVYDDNGVEVFNFGKYKGQSVSEVLKKDPGYYSWILNSDFTL
NTKAMLTKIRLRELTGK
NT seq
774 nt
NT seq
+upstream
nt +downstream
nt
atgaaactcaacctaaagaatcctatcgtcttttttgatctggaaacgaccgggacaaat
atcaactcagaccgaatcgtagaaatctgttatcttaaagtgtatcccaatgggaatgaa
gagtcgaaaactctccgtatcaatcccgaaatgcctatccctgccgaatcatctgctgtt
cacggtatttatgatgctgatgtagccgattgtcctacttttaaggaagtggcaaagagt
attgccaatgatatcgagggttgtgatctggctggtttcaattccaaccgttttgatatt
cccgtgttggcagaagaatttctgcgtgcgggtgtggatatcgatatgagtaagcgcaaa
tttgtcgatgtacaggtgattttccataagatggaacagcgtacccttacggctgcttat
aagttctattgtggccgtaatctggaagatgcgcatacagcggaagctgatacccgtgcc
acgtacgaggtactgatggctcaactcgatcgttatccggaagagttgcagaatgatatg
tctttcctggccgattattcaagctataacaagaatgtggattttgcaggacgtatggta
tatgacgacaatggggtagaggttttcaactttggtaaatacaaaggacagtcggtgagt
gaagtactgaaaaaagatccgggatattacagttggattctgaacagtgatttcacgttg
aatacaaaagccatgttgaccaagattcgtctgcgtgagttaaccggaaaataa
DBGET
integrated database retrieval system