Brachyistius frenatus (kelp perch): 138616618 Help Entry 138616618         CDS       T10614                                  Symbol rhoca Name (RefSeq) ras homolog family member Ca   KO K04513   Ras homolog gene family, member A Organism bfre  Brachyistius frenatus (kelp perch) Pathway bfre04081   Hormone signaling bfre04144   Endocytosis bfre04150   mTOR signaling pathway bfre04270   Vascular smooth muscle contraction bfre04310   Wnt signaling pathway bfre04350   TGF-beta signaling pathway bfre04510   Focal adhesion bfre04517   IgSF CAM signaling bfre04519   Cadherin signaling bfre04520   Adherens junction bfre04530   Tight junction bfre04621   NOD-like receptor signaling pathway bfre04625   C-type lectin receptor signaling pathway bfre04810   Regulation of actin cytoskeleton bfre05100   Bacterial invasion of epithelial cells bfre05132   Salmonella infection Brite KEGG Orthology (KO) [BR:bfre00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     138616618 (rhoca)    04350 TGF-beta signaling pathway     138616618 (rhoca)    04150 mTOR signaling pathway     138616618 (rhoca)   09133 Signaling molecules and interaction    04081 Hormone signaling     138616618 (rhoca)    04517 IgSF CAM signaling     138616618 (rhoca)    04519 Cadherin signaling     138616618 (rhoca)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     138616618 (rhoca)   09144 Cellular community - eukaryotes    04510 Focal adhesion     138616618 (rhoca)    04520 Adherens junction     138616618 (rhoca)    04530 Tight junction     138616618 (rhoca)   09142 Cell motility    04810 Regulation of actin cytoskeleton     138616618 (rhoca)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     138616618 (rhoca)    04625 C-type lectin receptor signaling pathway     138616618 (rhoca)   09153 Circulatory system    04270 Vascular smooth muscle contraction     138616618 (rhoca)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     138616618 (rhoca)    05100 Bacterial invasion of epithelial cells     138616618 (rhoca)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bfre04131]     138616618 (rhoca)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bfre04147]     138616618 (rhoca)    04031 GTP-binding proteins [BR:bfre04031]     138616618 (rhoca) Membrane trafficking [BR:bfre04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     138616618 (rhoca) Exosome [BR:bfre04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    138616618 (rhoca)   Exosomal proteins of other body fluids (saliva and urine)    138616618 (rhoca)   Exosomal proteins of colorectal cancer cells    138616618 (rhoca)   Exosomal proteins of bladder cancer cells    138616618 (rhoca) GTP-binding proteins [BR:bfre04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     138616618 (rhoca) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  138616618 NCBI-ProteinID:  XP_069547159 LinkDB All DBs Position Unknown AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPDEGRDMANKISAFGYLECSAKTKDGVREVFEMATRAALQ VRKRKKRSGCTLL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggcagccattcggaagaagctggtgattgttggcgacggagcttgcgggaaaacttgt cttctcattgttttcagtaaagatcagtttcccgaagtctacgtcccaacagtgtttgag aactacatcgctgatatcgaggttgatggaaaacaggtggagctggcgttgtgggatacc gcaggccaagaagactacgacaggttgaggcctctctcgtaccccgacacagatgtcatc ctcatgtgcttctccatcgacagcccagacagcttagaaaatatccctgagaagtggacg cccgaggtgaaacacttctgtcccaacgttcccatcatcctggtggggaacaagaaggac ctgaggaatgatgagcacacacggagagagctggccaagatgaagcaggagccggtgaag ccagatgaaggcagagacatggccaacaaaatcagtgcttttggctacttggagtgctct gccaagaccaaggacggcgtgcgggaggtgttcgagatggccactagagcagcgctgcag gtccgcaagcgcaaaaagagaagcggctgtacgctgctgtga

DBGET integrated database retrieval system