Brachyistius frenatus (kelp perch): 138617911 Help Entry 138617911         CDS       T10614                                  Name (RefSeq) protein S100-A1-like   KO K17274   protein S100-A10 Organism bfre  Brachyistius frenatus (kelp perch) Pathway bfre04382   Cornified envelope formation bfre05132   Salmonella infection Brite KEGG Orthology (KO) [BR:bfre00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     138617911  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     138617911  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bfre04147]     138617911 Exosome [BR:bfre04147]  Exosomal proteins   Exosomal proteins of microglial cells    138617911 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EF-hand_5 EF-hand_6 EF-hand_8 EH SPARC_Ca_bdg Motif Other DBs NCBI-GeneID:  138617911 NCBI-ProteinID:  XP_069549370 LinkDB All DBs Position Unknown AA seq 100 aa AA seqDB search MPSELEKAMESLITVFHRYASKDGQSGTLNRRELRELMENELSGFLKSQKDPAAVDRILK DLDTNGDGRVDFEEFVSLVVGLSIACEQCYQMHMKKTAKK NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgccttcagaactggagaaagccatggagtcactcattacagtgttccaccgttacgcc tctaaagacggtcagtctggcacactcaacaggcgagaactcagagagttgatggagaac gagctttctggcttccttaagtcccagaaggaccctgcagctgtggacaggatcctgaag gatctggataccaacggtgacggccgggtggactttgaggagttcgtttctctggttgtt ggattatccattgcctgtgagcagtgctatcagatgcacatgaaaaagacggcaaagaag tga

DBGET integrated database retrieval system