Brachyistius frenatus (kelp perch): 138619442 Help Entry 138619442         CDS       T10614                                  Name (RefSeq) protein S100-P-like   KO K17274   protein S100-A10 Organism bfre  Brachyistius frenatus (kelp perch) Pathway bfre04382   Cornified envelope formation bfre05132   Salmonella infection Brite KEGG Orthology (KO) [BR:bfre00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     138619442  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     138619442  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bfre04147]     138619442 Exosome [BR:bfre04147]  Exosomal proteins   Exosomal proteins of microglial cells    138619442 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 Nop5_N EF-hand_6 DUF3879 TusA Motif Other DBs NCBI-GeneID:  138619442 NCBI-ProteinID:  XP_069552017 LinkDB All DBs Position Unknown AA seq 96 aa AA seqDB search MASLEKSMENILLIFDRYAKESGNKKTLNKKELKKLIENELPTFMMGNPDAVKNIMKDLD QNKDDELDFEEFLPFIAGLLLACEKYRSTLSKKGGK NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atggcaagtttagagaaatccatggagaacatcttgttgatatttgaccgctatgccaaa gaaagtggaaataaaaagaccttaaacaagaaagaattgaaaaaactaattgagaatgag ttgcccacctttatgatgggaaaccctgatgctgttaaaaatatcatgaaggatctggac caaaacaaagatgatgagttggactttgaagaatttctacccttcatcgcaggcctctta ctcgcctgtgagaagtatcgctccacgctcagtaagaagggcgggaagtga

DBGET integrated database retrieval system