Brachyistius frenatus (kelp perch): 138629086 Help Entry 138629086         CDS       T10614                                  Symbol cldn18 Name (RefSeq) LOW QUALITY PROTEIN: claudin-18   KO K06087   claudin Organism bfre  Brachyistius frenatus (kelp perch) Pathway bfre03272   Virion - Hepatitis viruses bfre04382   Cornified envelope formation bfre04514   Cell adhesion molecule (CAM) interaction bfre04530   Tight junction Brite KEGG Orthology (KO) [BR:bfre00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     138629086 (cldn18)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecule (CAM) interaction     138629086 (cldn18)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     138629086 (cldn18)  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     138629086 (cldn18)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:bfre03037]     138629086 (cldn18)    04147 Exosome [BR:bfre04147]     138629086 (cldn18) Cilium and associated proteins [BR:bfre03037]  Other cilia and associated proteins   Stereociliary proteins    138629086 (cldn18) Exosome [BR:bfre04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    138629086 (cldn18)   Exosomal proteins of colorectal cancer cells    138629086 (cldn18) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PMP22_Claudin DUF6458 Motif Other DBs NCBI-GeneID:  138629086 NCBI-ProteinID:  XP_069568680 LinkDB All DBs Position Unknown AA seq 159 aa AA seqDB search MSPSILQNVGFILALIGAAAVIAATAMNRXRVLGKQAEDMWTSVYTFMDLWQACNTASSA FTDCXGILGFSGSFRAGRALLMVEEVLSVLGALLSALSLTRLMMNSMEDATKAKTSLTAS SWFLSVSLSLSGVCGVSGASVNQSXLVSARPPLLTTQED NT seq 480 nt NT seq  +upstreamnt  +downstreamnt atgtcgccttcaatcttgcagaatgttggattcattctggccctgatcggtgcagcagcc gtcatcgcagccactgccatgaacagancaagagtattggggaaacaggcagaggatatg tggacatctgtttacaccttcatggacctgtggcaggcctgcaacacagcatcatctgca ttcacagattgtnncggcatcctgggcttctcaggtagtttccgggctggtcgagccctg ctgatggtggaagaggtgctgagtgtgctcggggcgctcctatctgcgctctccctgacc cgcctcatgatgaacagcatggaggacgccacgaaggccaagacgagcctcactgcttca tcgtggttcctgtccgtctctctctctctctcaggtgtgtgtggcgtttcaggagcttct gtcaaccaatcgtgacttgtttcagcacgtccacctcttctaactacacaggaagactga

DBGET integrated database retrieval system