Buttiauxella ferragutiae: MNO13_15545 Help Entry MNO13_15545       CDS       T08104                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bft  Buttiauxella ferragutiae Pathway bft01100   Metabolic pathways bft01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bft00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MNO13_15545 (acpP)    00074 Mycolic acid biosynthesis     MNO13_15545 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MNO13_15545 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 HLH Motif Other DBs NCBI-ProteinID:  UNK59797 LinkDB All DBs Position complement(3355513..3355749) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVINSASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaattattggcgaacaactgggcgttaagcag gaagaagttatcaactccgcttccttcgtagaggacctgggcgctgattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaaaatcaccactgttcaggctgccattgattacatcaacggtcaccaggcgtaa

DBGET integrated database retrieval system