Buttiauxella ferragutiae: MNO13_15945 Help Entry MNO13_15945       CDS       T08104                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bft  Buttiauxella ferragutiae Pathway bft01100   Metabolic pathways bft01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bft00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MNO13_15945    00074 Mycolic acid biosynthesis     MNO13_15945   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MNO13_15945 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  UNK59868 LinkDB All DBs Position complement(3445551..3445799) Genome browser AA seq 82 aa AA seqDB search MKKEDIYQEVTGLLVKLFELSPEQITPQSRLYEDLDLDSIDAVDMVVHLQKRSGKKIKPE DFKSVRTVQDVVDAVERLHSEP NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgaagaaagaagatatttatcaggaagtcaccgggttactggttaagttatttgaactc tctcctgaacaaatcactccgcaatctcgtttatacgaagatttggatctcgatagtatc gatgctgtagatatggttgttcatctacaaaagcgcagcggtaaaaaaattaaaccggaa gattttaaatcggtacgcacagtacaggatgttgtagacgcggttgagcgtttgcatagc gagccgtaa

DBGET integrated database retrieval system