Botrytis cinerea (gray mold): BCIN_12g02760 Help Entry BCIN_12g02760     CDS       T01072                                  Symbol Bcrpb8 Name (RefSeq) Bcrpb8   KO K03016   DNA-directed RNA polymerases I, II, and III subunit RPABC3 Organism bfu  Botrytis cinerea (gray mold) Pathway bfu03020   RNA polymerase bfu03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:bfu00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     BCIN_12g02760 (Bcrpb8)   09124 Replication and repair    03420 Nucleotide excision repair     BCIN_12g02760 (Bcrpb8)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:bfu03021]     BCIN_12g02760 (Bcrpb8)    03400 DNA repair and recombination proteins [BR:bfu03400]     BCIN_12g02760 (Bcrpb8) Transcription machinery [BR:bfu03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      BCIN_12g02760 (Bcrpb8)   RNA polymerase III system    RNA polymerase III      BCIN_12g02760 (Bcrpb8)   RNA polymerase I system    RNA polymerase I      BCIN_12g02760 (Bcrpb8) DNA repair and recombination proteins [BR:bfu03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       BCIN_12g02760 (Bcrpb8) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RNA_pol_Rpb8 RNA_pol_RpbG Motif Other DBs NCBI-GeneID:  5438747 NCBI-ProteinID:  XP_001558138 UniProt:  A0A384JYN6 LinkDB All DBs Position 12:join(955511..955860,955971..956076) Genome browser AA seq 151 aa AA seqDB search MSGPQDAQLFDEHFTVNELDHKKYVRVGRIKATSTVDHSVSMLLDINTELFPLAVGDNIR VVLATSLNLDGTKDDGKGWRDANRMGLGGEASLADMFDYVCHGKIYKFEDQENSDLIKAY ISFGGLLMGLEGPYKKLTPLRVDYVYLLVKK NT seq 456 nt NT seq  +upstreamnt  +downstreamnt atgtctggtcctcaagacgcgcaacttttcgacgagcacttcaccgtcaacgaattggac cataagaaatatgtacgagtaggacgcatcaaggccacctccacggtcgaccattccgtg tcgatgcttttggatatcaataccgagctattccccttagccgtcggcgacaacattcgc gttgtgcttgcgacatctctgaatttggatggcacaaaggatgacggaaagggatggaga gatgctaaccgcatgggattggggggtgaggcctcgcttgcggatatgtttgattatgtt tgtcatgggaagatttacaagtttgaggatcaggagaacagtgatcttattaaggcatac atctccttcggcggattgttaatgggattggagggtccttacaagaagcttacaccttta agagtcgactatgtctatcttctcgtcaagaaatag

DBGET integrated database retrieval system