Blastomonas fulva: B5J99_02010 Help Entry B5J99_02010       CDS       T05612                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bfw  Blastomonas fulva Pathway bfw01100   Metabolic pathways bfw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bfw00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     B5J99_02010    00074 Mycolic acid biosynthesis     B5J99_02010   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     B5J99_02010 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ASR50387 LinkDB All DBs Position 425230..425514 Genome browser AA seq 94 aa AA seqDB search MSDIQTNGQNDAVERVVRNVLRDILGLSEDQVSGFDRDTELFGALPELDSMAVAGLLTEM EDRLDILIEDDEVDGELFENFGNLVDFARAKITA NT seq 285 nt NT seq  +upstreamnt  +downstreamnt gtgagcgatatccagaccaacggtcagaacgacgccgtcgagcgcgtggtacgcaatgtg ctgcgcgacattttgggcctgtccgaagaccaggtgagcgggttcgaccgcgataccgag ctgttcggcgcgctgcccgagctggattcgatggcggtggcggggctgctcaccgaaatg gaagaccgactcgacatcctgatcgaggatgacgaggtcgatggcgagctgttcgagaat ttcggcaatctcgtcgatttcgcgcgggcgaagatcaccgcgtga

DBGET integrated database retrieval system