Buchananella felis: ABYF36_00550 Help Entry ABYF36_00550      CDS       T10900                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bfy  Buchananella felis Pathway bfy01100   Metabolic pathways bfy01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bfy00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ABYF36_00550    00074 Mycolic acid biosynthesis     ABYF36_00550   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ABYF36_00550 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L50 PP-binding_2 Motif Other DBs NCBI-ProteinID:  XEO17494 LinkDB All DBs Position 137700..137948 Genome browser AA seq 82 aa AA seqDB search MAATENEILAGLAEIVNEETGVDVAEVTLEKSFSDDLDVDSLSMMTIVATAEERFEVRIP DEDATSLVTVGDAVNYILKAQA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggctgcaaccgagaacgagatcctggctggcctggctgagatcgtcaacgaggagacc ggcgtggatgtcgccgaggtgacgctggagaagtccttctccgacgacctggacgtcgac tccctgtccatgatgaccatcgtcgccaccgccgaggagcgcttcgaggtgcgtatcccc gacgaggacgccacctccctggtgaccgtcggcgacgccgtcaactacatcctcaaggct caggcctga

DBGET integrated database retrieval system