Bufo gargarizans (Asiatic toad): 122920015 Help Entry 122920015         CDS       T07965                                  Symbol INS Name (RefSeq) insulin   KO K04526   insulin Organism bgar  Bufo gargarizans (Asiatic toad) Pathway bgar04010   MAPK signaling pathway bgar04068   FoxO signaling pathway bgar04081   Hormone signaling bgar04114   Oocyte meiosis bgar04140   Autophagy - animal bgar04150   mTOR signaling pathway bgar04810   Regulation of actin cytoskeleton bgar04910   Insulin signaling pathway bgar04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:bgar00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     122920015 (INS)    04068 FoxO signaling pathway     122920015 (INS)    04150 mTOR signaling pathway     122920015 (INS)   09133 Signaling molecules and interaction    04081 Hormone signaling     122920015 (INS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     122920015 (INS)   09143 Cell growth and death    04114 Oocyte meiosis     122920015 (INS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     122920015 (INS)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     122920015 (INS)    04914 Progesterone-mediated oocyte maturation     122920015 (INS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bgar04052]     122920015 (INS) Cytokines and neuropeptides [BR:bgar04052]  Neuropeptides   Unclassified    122920015 (INS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Ins_beta PTH2 TgpA_N Motif Other DBs NCBI-GeneID:  122920015 NCBI-ProteinID:  XP_044125159 LinkDB All DBs Position 10:complement(26061872..26066889) Genome browser AA seq 106 aa AA seqDB search MALWIQCLPLAILLFVFTPTTQALANQHLCGPHLVEALYLVCGERGFYYYPKVRRDLEQP LVNGPQGNELDGMQLPSQDFQMRKRGIVEQCCHSTCSLYELENYCN NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atggccttgtggattcagtgtctccctctggcaattcttctcttcgtatttacacccacc acccaagccttagccaaccagcacctatgtgggcctcaccttgtagaagccttatacttg gtgtgtggagaaagaggtttctactactatccaaaggtcagaagagaccttgaacaacca ttagtgaacggacctcaaggcaatgagctggacgggatgcagctcccatcacaggacttt cagatgaggaagagaggcatcgtggaacagtgctgccatagcacatgctcattgtacgaa ctcgaaaactactgcaactga

DBGET integrated database retrieval system