Bufo gargarizans (Asiatic toad): 122920728 Help Entry 122920728         CDS       T07965                                  Symbol HRAS Name (RefSeq) GTPase HRas isoform X1   KO K02833   GTPase HRas Organism bgar  Bufo gargarizans (Asiatic toad) Pathway bgar04010   MAPK signaling pathway bgar04012   ErbB signaling pathway bgar04068   FoxO signaling pathway bgar04137   Mitophagy - animal bgar04140   Autophagy - animal bgar04144   Endocytosis bgar04150   mTOR signaling pathway bgar04210   Apoptosis bgar04218   Cellular senescence bgar04370   VEGF signaling pathway bgar04371   Apelin signaling pathway bgar04510   Focal adhesion bgar04540   Gap junction bgar04625   C-type lectin receptor signaling pathway bgar04810   Regulation of actin cytoskeleton bgar04910   Insulin signaling pathway bgar04912   GnRH signaling pathway bgar04916   Melanogenesis bgar05132   Salmonella infection Brite KEGG Orthology (KO) [BR:bgar00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     122920728 (HRAS)    04012 ErbB signaling pathway     122920728 (HRAS)    04370 VEGF signaling pathway     122920728 (HRAS)    04371 Apelin signaling pathway     122920728 (HRAS)    04068 FoxO signaling pathway     122920728 (HRAS)    04150 mTOR signaling pathway     122920728 (HRAS)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     122920728 (HRAS)    04140 Autophagy - animal     122920728 (HRAS)    04137 Mitophagy - animal     122920728 (HRAS)   09143 Cell growth and death    04210 Apoptosis     122920728 (HRAS)    04218 Cellular senescence     122920728 (HRAS)   09144 Cellular community - eukaryotes    04510 Focal adhesion     122920728 (HRAS)    04540 Gap junction     122920728 (HRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     122920728 (HRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     122920728 (HRAS)   09152 Endocrine system    04910 Insulin signaling pathway     122920728 (HRAS)    04912 GnRH signaling pathway     122920728 (HRAS)    04916 Melanogenesis     122920728 (HRAS)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     122920728 (HRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bgar04131]     122920728 (HRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bgar04147]     122920728 (HRAS)    04031 GTP-binding proteins [BR:bgar04031]     122920728 (HRAS) Membrane trafficking [BR:bgar04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     122920728 (HRAS)  Endocytosis   Macropinocytosis    Ras GTPases     122920728 (HRAS) Exosome [BR:bgar04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    122920728 (HRAS)   Exosomal proteins of colorectal cancer cells    122920728 (HRAS) GTP-binding proteins [BR:bgar04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     122920728 (HRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N G-alpha ATP_bind_1 Septin Ldh_1_N AAA_16 Motif Other DBs NCBI-GeneID:  122920728 NCBI-ProteinID:  XP_044126373 LinkDB All DBs Position 10:34750193..34838964 Genome browser AA seq 195 aa AA seqDB search MRGFWTMTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLD ILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLV GNKCDLPARTVETRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPP DESEKGCLNCKCVVS NT seq 588 nt NT seq  +upstreamnt  +downstreamnt atgagggggttctggacaatgactgagtacaagctggtggtggtgggagcaggaggcgtt gggaaaagtgccttaaccattcagcttatacagaaccactttgttgatgagtatgaccca accattgaggattcctacagaaaacaggtcgtcatagatggagaaacttgcttgctggac atcttggacacagcaggtcaagaggaatacagtgcgatgagggaccagtacatgagaaca ggagaagggtttttatgtgtttttgccattaacaacaccaagtcttttgaggatattcac caatacagggaacaaataaaaagggtcaaggactctgacgacgttccaatggttttggtg gggaacaagtgtgacctcccagccagaactgtggagacccgacaagctcaggacctggct agaagttacggcattccttacattgaaacatctgctaaaaccaggcagggagtagaagat gccttttacacgttagtgagagagatccggcagcataaattacggaagctcaatcctcct gacgagagtgagaaaggatgtctgaactgcaagtgcgttgtgtcctga

DBGET integrated database retrieval system