Bufo gargarizans (Asiatic toad): 122920902 Help Entry 122920902         CDS       T07965                                  Symbol RRAS2 Name (RefSeq) ras-related protein R-Ras2   KO K07830   Ras-related protein R-Ras2 Organism bgar  Bufo gargarizans (Asiatic toad) Pathway bgar04010   MAPK signaling pathway bgar04137   Mitophagy - animal bgar04140   Autophagy - animal bgar04218   Cellular senescence bgar04371   Apelin signaling pathway bgar04625   C-type lectin receptor signaling pathway bgar04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:bgar00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     122920902 (RRAS2)    04371 Apelin signaling pathway     122920902 (RRAS2)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     122920902 (RRAS2)    04137 Mitophagy - animal     122920902 (RRAS2)   09143 Cell growth and death    04218 Cellular senescence     122920902 (RRAS2)   09142 Cell motility    04810 Regulation of actin cytoskeleton     122920902 (RRAS2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     122920902 (RRAS2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bgar04147]     122920902 (RRAS2)    04031 GTP-binding proteins [BR:bgar04031]     122920902 (RRAS2) Exosome [BR:bgar04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    122920902 (RRAS2)   Exosomal proteins of bladder cancer cells    122920902 (RRAS2) GTP-binding proteins [BR:bgar04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     122920902 (RRAS2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Arf Roc RsgA_GTPase SLFN-g3_helicase GTP_EFTU NPHI_C FeThRed_B Motif Other DBs NCBI-GeneID:  122920902 NCBI-ProteinID:  XP_044126655 LinkDB All DBs Position 10:13452677..13459045 Genome browser AA seq 127 aa AA seqDB search MREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMVLVGNKADLEHQRQV TQEEGQQSAQQLKVTYMEASAKIRMNVDQAFHELVRVVRKFQEQECPPSPEPTRKEKDKK GCHCVLF NT seq 384 nt NT seq  +upstreamnt  +downstreamnt atgagagaacagtacatgaggaccggggaggggttcttactcgtcttctccgtaacggac agaggaagttttgaagaaatctataaattccagagacagatcctccgagtaaaggatcgg gatgaatttcctatggtcctggttgggaacaaggcagatctggagcatcagagacaggta acgcaggaggaagggcagcagtcggcgcagcagctgaaagtgacgtatatggaggcgtcc gccaaaatccggatgaacgttgatcaagcttttcatgaactggtgcgagtagtgaggaag tttcaggagcaggaatgccccccgtctccggagccgacgcggaaggagaaggacaagaaa ggctgtcactgcgtcctgttctga

DBGET integrated database retrieval system