Bufo gargarizans (Asiatic toad): 122922723 Help Entry 122922723         CDS       T07965                                  Name (RefSeq) histone H2A type 1-like   KO K11251   histone H2A Organism bgar  Bufo gargarizans (Asiatic toad) Pathway bgar03082   ATP-dependent chromatin remodeling bgar04217   Necroptosis Brite KEGG Orthology (KO) [BR:bgar00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     122922723  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     122922723  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bgar03036]     122922723   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bgar04147]     122922723 Chromosome and associated proteins [BR:bgar03036]  Eukaryotic type   Nucleosome assembly factors    Histones     122922723 Exosome [BR:bgar04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    122922723 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  122922723 NCBI-ProteinID:  XP_044129358 UniProt:  Q90ZD8 LinkDB All DBs Position Unknown AA seq 130 aa AA seqDB search MSGRGKQGGKVRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK TESSKPAKSK NT seq 393 nt NT seq  +upstreamnt  +downstreamnt atgtctggacgcggcaaacaaggaggcaaagtgcgggctaaggccaagacccgctcatcc cgggcagggctccagttcccggtcggccgtgtgcacaggctcctccgcaagggcaactac gcccagagggtgggcgccggcgctcccgtctacttggccgccgtgctcgagtatctcacc gccgagatcctggagctggccggcaatgccgcccgcgacaacaagaagacccgcatcatc ccccgtcacctgcagctggccgtgcgcaacgacgaggagctcaacaagctgctgggcgga gtcaccatcgcccagggcggcgtcctgcccaacatccaggccgtgctgctgcccaagaag accgagagcagcaagccggccaagagcaagtga

DBGET integrated database retrieval system