Bufo gargarizans (Asiatic toad): 122943453 Help Entry 122943453         CDS       T07965                                  Symbol RAB7A Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism bgar  Bufo gargarizans (Asiatic toad) Pathway bgar04137   Mitophagy - animal bgar04140   Autophagy - animal bgar04144   Endocytosis bgar04145   Phagosome bgar04148   Efferocytosis bgar05132   Salmonella infection Brite KEGG Orthology (KO) [BR:bgar00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     122943453 (RAB7A)    04145 Phagosome     122943453 (RAB7A)    04140 Autophagy - animal     122943453 (RAB7A)    04137 Mitophagy - animal     122943453 (RAB7A)    04148 Efferocytosis     122943453 (RAB7A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     122943453 (RAB7A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bgar04131]     122943453 (RAB7A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bgar04147]     122943453 (RAB7A)    04031 GTP-binding proteins [BR:bgar04031]     122943453 (RAB7A) Membrane trafficking [BR:bgar04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     122943453 (RAB7A) Exosome [BR:bgar04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    122943453 (RAB7A)   Exosomal proteins of other body fluids (saliva and urine)    122943453 (RAB7A)   Exosomal proteins of colorectal cancer cells    122943453 (RAB7A)   Exosomal proteins of bladder cancer cells    122943453 (RAB7A) GTP-binding proteins [BR:bgar04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     122943453 (RAB7A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 cobW nSTAND3 Septin PduV-EutP AAA_7 AAA_22 AAA_16 AAA_24 AAA_5 NTPase_1 FLYWCH_N ATPase_2 SRPRB NB-ARC NACHT AAA_14 ABC_tran ATP-synt_ab Motif Other DBs NCBI-GeneID:  122943453 NCBI-ProteinID:  XP_044157147 LinkDB All DBs Position 7:complement(164328332..164351799) Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFTNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQVWCHSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDKNDRAKASAESCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacgtccaggaagaaagtgcttctgaaggtgatcatcctgggagactctggggttggg aagacttcgctcatgaaccagtatgtcaataagaagttcactaatcagtacaaggccaca atcggggcggacttcttaaccaaagaagtgatggtggatgaccggttggtgacaatgcag atatgggacacggccgggcaggagcggttccagtccctgggggtggccttttatcgagga gccgactgctgcgtcctggtcttcgacgtcaccgctcctaatacttttaagactctggac agttggagagacgagttcctcatccaggccagtccccgggatcccgaaaactttccattt gtggtcctgggaaacaagatagaccttgaaaacagacaagtcaccacaaagcgggcacaa gtctggtgtcatagcaaaaataacatcccttactttgaaaccagtgctaaggaggcgata aacgtggagcaggcttttcagacgattgcacggaacgcacttaaacaggaaacagaggtc gagctgtacaatgaattcccagagcccattaaactggacaagaacgaccgggcaaaggcg tctgcggagagctgcagctgctga

DBGET integrated database retrieval system