Bufo gargarizans (Asiatic toad): 4356064 Help Entry 4356064           CDS       T07965                                  Symbol ND3 Name (RefSeq) NADH dehydrogenase subunit 3   KO K03880   NADH-ubiquinone oxidoreductase chain 3 [EC:7.1.1.2] Organism bgar  Bufo gargarizans (Asiatic toad) Pathway bgar00190   Oxidative phosphorylation bgar01100   Metabolic pathways Module bgar_M00142   NADH:ubiquinone oxidoreductase, mitochondria Brite KEGG Orthology (KO) [BR:bgar00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     4356064 (ND3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:bgar03029]     4356064 (ND3) Enzymes [BR:bgar01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      4356064 (ND3) Mitochondrial biogenesis [BR:bgar03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA-encoded proteins    Mitochondrial respiratory chain complex I     4356064 (ND3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Oxidored_q4 DUF6116 Motif Other DBs NCBI-GeneID:  4356064 NCBI-ProteinID:  YP_778624 UniProt:  Q072D5 LinkDB All DBs Position MT:9666..10007 Genome browser AA seq 113 aa AA seqDB search MTLFVILTLVIVSILASISFWLPTINSDSEKLSPYECGFDPLGSARLPYSMRFFLVAILF LLFDLEIALLLPTPWAAQLPYPTLSILLASVILILLTLGFVYEWLQGGLEWAE NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atgaccctatttgttattcttaccctagtaattgtttcaattttggcctccatcagcttc tgattgccaaccatcaactcagactcagaaaaactctcaccttatgagtgcggcttcgac ccgctaggatccgcccgcctcccatactccatgcgattcttcctagtcgccattcttttt ctcctctttgacctagaaatcgcccttctcctccccaccccctgagccgcacaacttccc taccccaccctatctattcttctagcatcagtgatcttaattcttttaaccttgggattt gtctatgagtgacttcaagggggcctagaatgagctgagtaa

DBGET integrated database retrieval system