Burkholderia gladioli BSR3: bgla_1g06200 Help Entry bgla_1g06200      CDS       T01464                                  Name (GenBank) DNA-binding protein Fis   KO K03557   Fis family transcriptional regulator, factor for inversion stimulation protein Organism bgd  Burkholderia gladioli BSR3 Brite KEGG Orthology (KO) [BR:bgd00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:bgd03000]     bgla_1g06200    03036 Chromosome and associated proteins [BR:bgd03036]     bgla_1g06200    03400 DNA repair and recombination proteins [BR:bgd03400]     bgla_1g06200 Transcription factors [BR:bgd03000]  Prokaryotic type   Helix-turn-helix    Other families     bgla_1g06200 Chromosome and associated proteins [BR:bgd03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     bgla_1g06200 DNA repair and recombination proteins [BR:bgd03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Facilitator       bgla_1g06200 SSDB OrthologParalogGFIT Motif Pfam:  HTH_8 HTH_30 HTH_17 Fis_N Xre-like-HTH Phage_NinH NUMOD1 Motif Other DBs NCBI-ProteinID:  AEA59312 UniProt:  F2L7Q1 LinkDB All DBs Position 1:complement(685150..685383) Genome browser AA seq 77 aa AA seqDB search MSKHNIEQCVRDSLDVYFRDLDGSNPHDVYDMVMSCVEKPMLEVVLEQAGGNQSLAAEYL GINRNTLRKKLQQHGLL NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcaagcacaacatcgaacaatgtgtccgcgacagcctggacgtgtatttccgggat ctcgacggctccaatccgcatgacgtctacgacatggtgatgtcctgcgtcgagaagccg atgctcgaggtggtgctcgaacaggcgggcggcaaccagtcgctcgccgccgagtacctc ggcatcaaccgcaacaccttgcgcaagaagctgcagcagcacgggctgctgtag

DBGET integrated database retrieval system