KEGG   Burkholderia sp. CCGE1003: BC1003_1222
Entry
BC1003_1222       CDS       T01314                                 
Name
(GenBank) helicase c2
  KO
K03722  ATP-dependent DNA helicase DinG [EC:5.6.2.3]
Organism
bgf  Burkholderia sp. CCGE1003
Brite
KEGG Orthology (KO) [BR:bgf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bgf03400]
    BC1003_1222
Enzymes [BR:bgf01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.3  DNA 5'-3' helicase
     BC1003_1222
DNA repair and recombination proteins [BR:bgf03400]
 Prokaryotic type
  Other factors with a suspected DNA repair function
   DNA helicases
    BC1003_1222
SSDB
Motif
Pfam: Helicase_C_2 DEAD DEAD_2 Glyco_tran_10_N T4SS-DNA_transf
Other DBs
NCBI-ProteinID: ADN57199
UniProt: E1T456
LinkDB
Position
1:1403720..1405999
AA seq 759 aa
MNSPLETSPRASTAGATSQTGTAESRPAASSLSASLNPRRAAELNEIFADNGLLARQIDG
YRSRASQIEMSRAVAAAMEASGRAMPEPAMFEAQKRPARRLQTAGADAPAEAAEVDEAQP
LDGGENTLIVEAGTGTGKTYAYLVPAMLWGGKVIVSTGTKHLQDQLFQRDIPTVRDALAV
PVSVAMLKGRANYLCHYYLQRTADNGRLPSRQETSYLQDIVRFAKITRTGDKAELASVPE
TAAVWSMVTSTRENCLGQECPHYKDCFVMQARREAQQADIVVVNHHLFFADIMLRDTGMA
ELLPTANTIIFDEAHQLPETATLFFGETLSTAQFLELARDSVAEGLGHARDAVDWVKLGS
TLERAARDVRLAFKEDSVRLSIGQLPDDHPLFAALEVLETELNALESALAGQAERAESIG
ACLRRARELQAVLAGWTTPPTELEREAADAAPGGTAEVKGERADPNEKVRWIEVFAHTVQ
LHETPLSVAPIFAKQRAGVPRAWIFTSATLSVRGDFTHYAAQMGLNAKRSMTLPSPFDYP
SQGLLYVPRNLPQPSSPMFTDAVFDAALPAIEASGGGVFMLCTTLRAVDRISAKLRDVIE
ARGWNYPLLVQGDASRTELLDRFRAYGNAILVGSQSFWEGVDVRGDALSLVVIDKLPFAP
PDDPVLSARLDALTKKGLSPFAVHQLPQAVITLKQGAGRLIRAETDRGVLMICDTRLVDK
PYGRRIWQSLPPFKRTREIEVVREFFEESGNVAQRAGLD
NT seq 2280 nt   +upstreamnt  +downstreamnt
ttgaattcaccgcttgaaacctcaccacgcgcgagtaccgcgggcgcgacgtcacagacc
ggcacagccgagtcgcgtcctgccgcgtcctcgttgagcgcatcgctcaatccgcggcgc
gccgcggaactcaacgaaattttcgccgacaacggcctgctcgcgcggcagatcgacggc
tatcgctcgcgcgcgtcgcaaatcgaaatgtcccgcgcggtggccgccgcgatggaagcg
tccggtcgtgcgatgcccgagcccgcaatgttcgaagcgcaaaagcgtccggcgcggcgt
ctgcaaaccgcgggcgccgacgcgccagccgaggccgccgaagtcgacgaagcacagccg
ctcgacggcggcgagaacacgctgatcgtcgaagcgggtacgggcaccggcaagacctat
gcatatctggtgccggccatgttgtggggcggcaaggtgatcgtctctacgggcaccaag
cacttgcaggatcagctttttcagcgcgatattccgacggttcgcgacgcacttgcggtg
cctgtgtcggtggcaatgctcaaggggcgcgcgaattacctgtgccactactatctgcag
cgcacggccgataacggccgcttgccgtcgcgccaggaaacctcgtatctgcaggacatc
gtgcgctttgcgaagatcacgcgcaccggcgacaaggctgagctggcgagcgtgcccgaa
acggcggcggtgtggtcgatggtcacgtccacgcgcgaaaactgtctcggccaggagtgt
ccgcactacaaggactgcttcgtgatgcaggcgcgccgcgaggcacagcaggccgacatc
gtggtggtgaatcaccatctattttttgccgacatcatgttgcgcgataccggcatggct
gaactgctgcccaccgccaacacgatcatcttcgacgaagcgcatcagcttcccgaaacg
gccacactgtttttcggtgagacgctttcgaccgcgcagtttctcgagctcgcgcgcgat
tcggtggccgagggtttgggccacgcacgcgacgcggtggactgggtcaagctcggctcc
acgttggaacgcgccgcgcgcgacgtgcggctcgcgttcaaggaagattcggtgcgtctg
tcgatcggccagttgcccgacgaccatccgttattcgctgcgctcgaagtgctcgagacc
gagctcaatgcgctcgagtccgcgctcgcggggcaggccgagcgcgccgagtcgatcggc
gcatgtctgcgccgcgcccgcgagttgcaagcggtgctggctggctggaccacgccgcca
acggagctcgagcgggaagccgcggatgcggctcccggcggcacggccgaggtcaagggc
gagcgcgccgatccgaatgaaaaggtgcgctggatcgaagtcttcgcgcataccgtgcag
ttgcacgagacgccgctctcggtcgcgccgattttcgcgaagcagcgtgccggcgtgccc
cgcgcgtggatcttcacgtcggccaccttgtcggtgcgcggcgacttcacgcactatgcc
gcgcaaatgggcctcaacgcgaagcgttcgatgaccttgccaagcccgttcgactatccg
tcgcaagggctgctgtatgtgccgcgcaacctgccgcagccgtcgtcgccgatgttcacc
gacgccgtattcgacgcggcgttgccggcaatcgaagcgtcgggcggcggcgtattcatg
ttgtgcacgacgttgcgcgcggtggaccgcatctctgcgaaactgcgcgatgtgatcgag
gcgcgcggctggaactatccgctgctcgtccagggcgatgcaagccgcacggaattgctg
gatcgcttccgcgcctacggtaatgcgattctcgtgggcagtcagagcttctgggaaggt
gtcgacgtgcgcggcgacgctctatcgctcgtcgtgatcgacaagctgccttttgcgccg
cctgacgacccggttctgtcggcgcggctcgatgcgctcacgaagaaaggtttgagcccg
tttgcggtccatcaactgccgcaggcggtcatcacgctcaagcagggcgcaggtcgcctg
attcgcgcggagacggaccgtggcgtgctgatgatctgcgatacgcgtcttgtcgataag
ccttatggacgccggatctggcaaagcctgccgccgttcaagcgtactcgcgagatagaa
gtggtgcgcgagttctttgaagagagcggcaacgtggcccaacgggcggggcttgactag

DBGET integrated database retrieval system