Blastomyces gilchristii: BDBG_06547 Help Entry BDBG_06547        CDS       T06540                                  Name (RefSeq) uncharacterized protein   KO K11511   centromere protein S Organism bgh  Blastomyces gilchristii Pathway bgh03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:bgh00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     BDBG_06547  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bgh03036]     BDBG_06547    03400 DNA repair and recombination proteins [BR:bgh03400]     BDBG_06547 Chromosome and associated proteins [BR:bgh03036]  Eukaryotic type   Centromeric chromatin formation proteins    Kinetochore proteins     Centromere proteins      BDBG_06547 DNA repair and recombination proteins [BR:bgh03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      BDBG_06547 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-S DUF5759 Motif Other DBs NCBI-GeneID:  8503162 NCBI-ProteinID:  XP_002623108 UniProt:  A0A179USI9 LinkDB All DBs Position Unknown AA seq 126 aa AA seqDB search MAEQESDSVALEERLKSALWLAIGRIVDDETIKLGVDATPQFIGALTEMVWAQIGKIPPT VLGYPCRDVKEISGERYIHADIKFRDRGTRPGGIRQTCGTVDDQLIRCDASGTPKRRLGI NIASIY NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atggcagagcaagaaagtgattccgtggcccttgaagagcgcctgaagtcggctctttgg cttgcaattggtagaatcgtggacgatgaaacgatcaagctgggtgttgatgccactcca cagtttataggggcactgacggagatggtttgggcacagataggtaaaatccctcccact gtcctaggttatccttgccgtgacgtgaaggagatttcaggggagcgttatatccatgct gatatcaagttcagagaccgtgggacaagacctggaggcattcgccaaacatgcgggacg gtcgacgatcaacttatccgatgtgatgcttctggcacgccgaaacgaaggcttggaatc aatattgcgagcatttattga

DBGET integrated database retrieval system