Blastomyces gilchristii: BDBG_06664 Help Entry BDBG_06664        CDS       T06540                                  Name (RefSeq) rho-like protein rac1A   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism bgh  Blastomyces gilchristii Pathway bgh04145   Phagosome bgh04148   Efferocytosis bgh04620   Toll-like receptor signaling pathway bgh05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:bgh00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     BDBG_06664    04148 Efferocytosis     BDBG_06664  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     BDBG_06664  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     BDBG_06664  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bgh04131]     BDBG_06664   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bgh04147]     BDBG_06664    04031 GTP-binding proteins [BR:bgh04031]     BDBG_06664 Membrane trafficking [BR:bgh04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     BDBG_06664  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     BDBG_06664   Macropinocytosis    Ras GTPases     BDBG_06664  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     BDBG_06664 Exosome [BR:bgh04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    BDBG_06664   Exosomal proteins of other body fluids (saliva and urine)    BDBG_06664   Exosomal proteins of colorectal cancer cells    BDBG_06664   Exosomal proteins of bladder cancer cells    BDBG_06664 GTP-binding proteins [BR:bgh04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     BDBG_06664 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  8503200 NCBI-ProteinID:  XP_002623225 UniProt:  A0A179US72 LinkDB All DBs Position Unknown AA seq 199 aa AA seqDB search MASGPATQSLKCVVTGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSASVMVDGKPISLG LWDTAGQEDYDRLRPLSYPQTDVFLICFSIVSPPSFDNVKAKWHPEIEHHAPNVPIILVG TKLDLREDKATAESLRAKKMEPVSYEQALAVAKEIKAQKYLECSALTQRNLKSVFDEAIR AVLNPRPVAKPKKSKCNLL NT seq 600 nt NT seq  +upstreamnt  +downstreamnt atggcctctggaccagctactcagtcactgaagtgtgttgttactggcgacggtgctgtt ggcaagacatgtctccttatttcctacaccacaaatgccttccccggagagtatattcct actgtgttcgacaactactccgccagtgtaatggttgatgggaagccaatcagtcttggt ctttgggatactgctggacaggaagattacgacagactacgtcctttgtcatatccacag accgatgtttttcttatatgcttttctatcgtcagcccgccgtctttcgataacgtcaaa gcgaagtggcacccggagatcgaacatcacgcgcccaatgtccccataattctagtaggg accaaactggatctgcgagaggacaaggctactgctgaaagtcttcgtgcgaagaagatg gaaccagtgtcttatgaacaagccctcgcagttgccaaagagatcaaagcacaaaaatac ctcgaatgttcagccctcacgcagcgaaatctgaagagtgtcttcgatgaagctattcgt gccgtgctgaatccacgtcctgttgcgaaacctaaaaaatccaaatgcaatctcctctaa

DBGET integrated database retrieval system