Blastomyces gilchristii: BDBG_16852 Help Entry BDBG_16852        CDS       T06540                                  Name (RefSeq) uncharacterized protein   KO K11253   histone H3 Organism bgh  Blastomyces gilchristii Brite KEGG Orthology (KO) [BR:bgh00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bgh03036]     BDBG_16852   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bgh04147]     BDBG_16852 Chromosome and associated proteins [BR:bgh03036]  Eukaryotic type   Nucleosome assembly factors    Histones     BDBG_16852 Exosome [BR:bgh04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    BDBG_16852 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone Pes-10 RET_CLD4 Motif Other DBs NCBI-GeneID:  42528823 NCBI-ProteinID:  XP_031577832 UniProt:  A0A179UK02 LinkDB All DBs Position Unknown AA seq 93 aa AA seqDB search SDIMKIESLYEICFYQKSGNFIFLKIIFTCLVHEINEGNHQFQCSALDIIQVTAEFTLAT LFKYDVKTITHHDCVTLTVRNTQLMMNIVKTLR NT seq 281 nt NT seq  +upstreamnt  +downstreamnt tctctgatatcatgaaaatagagtctctttatgagatctgtttttatcagaagtcaggga attttatatttctcaagatcatcttcacctgccttgtccatgaaatcaatgagggaaatc atcaatttcagtgttctgctcttgatatcattcaagtgacagcagagttcaccctggcca cactttttaagtatgatgttaagacaataactcatcatgactgtgttactcttactgtga gaaatacacagttaatgatgaatattgtaaagactctgaga

DBGET integrated database retrieval system