Blastomyces gilchristii: BDBG_17123 Help Entry BDBG_17123        CDS       T06540                                  Name (RefSeq) uncharacterized protein   KO K11253   histone H3 Organism bgh  Blastomyces gilchristii Brite KEGG Orthology (KO) [BR:bgh00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bgh03036]     BDBG_17123   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bgh04147]     BDBG_17123 Chromosome and associated proteins [BR:bgh03036]  Eukaryotic type   Nucleosome assembly factors    Histones     BDBG_17123 Exosome [BR:bgh04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    BDBG_17123 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone Motif Other DBs NCBI-GeneID:  8500801 NCBI-ProteinID:  XP_031578496 UniProt:  A0A179UL87 LinkDB All DBs Position Unknown AA seq 64 aa AA seqDB search SDIMKIESLCEICFYQKSENLIFLKIIFTHLVCEIDERNYQFQCSVLDVIQVIAEFTLIT LFKY NT seq 194 nt NT seq  +upstreamnt  +downstreamnt tctctgatataatgaaaatagagtctctctgtgagatctgtttctatcagaagtcagaga atcttatatttctcaagatcatcttcacacaccttgtctgtgaaattgatgagagaaatt atcaattccagtgttctgttcttgatgttattcaagtgatagcagagttcactctgatca cactttttaagtat

DBGET integrated database retrieval system