Brenneria goodwinii: AWC36_21930 Help Entry AWC36_21930       CDS       T05061                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism bgj  Brenneria goodwinii Pathway bgj02024   Quorum sensing bgj03018   RNA degradation Brite KEGG Orthology (KO) [BR:bgj00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     AWC36_21930 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     AWC36_21930 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:bgj03019]     AWC36_21930 (hfq)    03036 Chromosome and associated proteins [BR:bgj03036]     AWC36_21930 (hfq) Messenger RNA biogenesis [BR:bgj03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      AWC36_21930 (hfq) Chromosome and associated proteins [BR:bgj03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     AWC36_21930 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  ATA26544 UniProt:  A0A0G4JVC6 LinkDB All DBs Position 5031978..5032274 Genome browser AA seq 98 aa AA seqDB search MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAIS TVVPSRPVSHHSNNPGTSNYHGSNPAGQQQPQESDDAE NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atggctaaggggcaatctttacaagatccgttcctgaacgcattgcgtcgcgaacgtgtt ccggtttcgatttatttggtgaatggtattaagttgcagggtcagattgaatctttcgat cagtttgtcattttgttaaaaaatacggttagccagatggtgtataaacacgccatttct acagtagttccatctcgtccggtgtctcatcacagtaataatccaggcaccagcaattat catggtagcaatccggctggacagcaacagccgcaggaaagtgatgacgctgaataa

DBGET integrated database retrieval system