Bradyrhizobium genosp. L: IC762_15930 Help Entry IC762_15930       CDS       T09261                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bgk  Bradyrhizobium genosp. L Pathway bgk01100   Metabolic pathways bgk01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bgk00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     IC762_15930    00074 Mycolic acid biosynthesis     IC762_15930   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     IC762_15930 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  QPF87685 UniProt:  A0A7S9GWH6 LinkDB All DBs Position 3410019..3410258 Genome browser AA seq 79 aa AA seqDB search MSEIGERVKKIVVEHLGVEPDKVIDSASFIDDLGADSLDTVELVMAFEEEFGCEIPDDAA ETILTVGDATKFLEKNAKS NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagtgagattggcgagcgggttaagaagattgtggtcgaacacctcggtgtcgagccc gacaaggtgatcgatagcgcgagcttcatcgatgacctcggcgccgacagtctcgacacg gtcgagctcgtgatggcttttgaagaagagttcggttgcgagattcccgacgacgcggcg gagaccatcctgaccgtcggcgacgccaccaagtttctcgagaagaacgcgaagagctga

DBGET integrated database retrieval system