Burkholderia glumae BGR1: bglu_1g31070
Help
Entry
bglu_1g31070 CDS
T00905
Name
(GenBank) Single-strand DNA-binding protein
KO
K03111
single-strand DNA-binding protein
Organism
bgl
Burkholderia glumae BGR1
Pathway
bgl03030
DNA replication
bgl03430
Mismatch repair
bgl03440
Homologous recombination
Brite
KEGG Orthology (KO) [BR:
bgl00001
]
09120 Genetic Information Processing
09124 Replication and repair
03030 DNA replication
bglu_1g31070
03430 Mismatch repair
bglu_1g31070
03440 Homologous recombination
bglu_1g31070
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03032 DNA replication proteins [BR:
bgl03032
]
bglu_1g31070
03400 DNA repair and recombination proteins [BR:
bgl03400
]
bglu_1g31070
03029 Mitochondrial biogenesis [BR:
bgl03029
]
bglu_1g31070
DNA replication proteins [BR:
bgl03032
]
Prokaryotic type
DNA Replication Initiation Factors
Initiation factors (bacterial)
bglu_1g31070
DNA repair and recombination proteins [BR:
bgl03400
]
Prokaryotic type
SSBR (single strand breaks repair)
MMR (mismatch excision repair)
Other MMR factors
bglu_1g31070
TLS (translesion DNA synthesis) factors
Other SOS response factors
bglu_1g31070
Mitochondrial biogenesis [BR:
bgl03029
]
Mitochondrial DNA transcription, translation, and replication factors
Mitochondrial DNA replication factors
Other Mitochondrial DNA replication factors
bglu_1g31070
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
SSB
tRNA_anti-codon
Motif
Other DBs
NCBI-ProteinID:
ACR30170
LinkDB
All DBs
Position
1:complement(3533849..3534409)
Genome browser
AA seq
186 aa
AA seq
DB search
MASVNKVILVGNLGADPEVRYLPSGDAVANIRLATTDRYKDKASGDFKEMTEWHRVAFFG
RLAEIVNEYLKKGSSVYIEGRLRTRKWQGQDGQDRYSTEIVADQMQMLGGRGGSGGGGGG
GDDGYGGGGYGGGGGRGGDMERGGGGGRASGGGGGASRGGSGGGGSSRPSQPAGGGLDEM
DDDIPF
NT seq
561 nt
NT seq
+upstream
nt +downstream
nt
atggcatccgtcaacaaggtcattctcgtcggtaatctgggcgccgaccccgaagtgcgc
tacctgccgagcggcgacgcggtggcgaacatccgcctggcgacgaccgatcgctacaag
gacaaggcgagcggcgatttcaaggaaatgaccgagtggcaccgcgtggcgtttttcggc
cggctggccgagatcgtcaacgagtacctgaagaagggctcgtcggtgtatatcgaaggg
cgcctgcgcacgcgcaagtggcagggccaggacggccaggaccgttactcgaccgaaatc
gtcgccgaccagatgcagatgctgggcggccgtggtgggtcgggcggcggcggcggtggt
ggtgacgacggttacggcggcggcggctacggtggtggcggcggtcgcggcggcgacatg
gagcgcggcggcggcggtggccgtgcttccggcggtggcggcggtgcctcgcgcggcggt
agcggcggcggcggttcgagccgtccgagccagccggccggtggcggactcgacgagatg
gatgacgatattccgttctga
DBGET
integrated database retrieval system