Burkholderia glumae BGR1: bglu_2g19930
Help
Entry
bglu_2g19930 CDS
T00905
Name
(GenBank) Two component CheB methylesterase
KO
K03412
two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:
3.1.1.61
3.5.1.44
]
Organism
bgl
Burkholderia glumae BGR1
Pathway
bgl02020
Two-component system
bgl02030
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:
bgl00001
]
09130 Environmental Information Processing
09132 Signal transduction
02020 Two-component system
bglu_2g19930
09140 Cellular Processes
09142 Cell motility
02030 Bacterial chemotaxis
bglu_2g19930
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02022 Two-component system [BR:
bgl02022
]
bglu_2g19930
02035 Bacterial motility proteins [BR:
bgl02035
]
bglu_2g19930
Enzymes [BR:
bgl01000
]
3. Hydrolases
3.1 Acting on ester bonds
3.1.1 Carboxylic-ester hydrolases
3.1.1.61 protein-glutamate methylesterase
bglu_2g19930
3.5 Acting on carbon-nitrogen bonds, other than peptide bonds
3.5.1 In linear amides
3.5.1.44 protein-glutamine glutaminase
bglu_2g19930
Two-component system [BR:
bgl02022
]
CheA family
CheA-CheYBV (chemotaxis)
bglu_2g19930
Bacterial motility proteins [BR:
bgl02035
]
Flagellar system
Chemotaxis proteins
Two component system proteins
bglu_2g19930
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
CheB_methylest
Response_reg
Motif
Other DBs
NCBI-ProteinID:
ACR32316
LinkDB
All DBs
Position
2:complement(2476184..2477233)
Genome browser
AA seq
349 aa
AA seq
DB search
MTKLLIVDDSALMRRKLSSLFEQAGGFDIRLARNGREAVEENRVFQPDVMTLDINMPEMD
GLTALSLVMAERPTPVVMVSSLTVKSALATFEALALGAVDYVAKPDGTISLHLARIEAEL
LAKVRHAAQARLRPAPPVRAAPVRERAPLRLAPAAVPSHETGLVLIGVSTGGPRALEDIL
PQLPASFPWPVLIAQHMPAAFTSLFAQRLDRLCALQVQEVTEPMALAPGKIYVARGGGDV
VVSKRRDQRVALPQPEHAEHLWHPSVELLGRSALQHYPAQELIGVMLTGMGHDGAQAFAE
IHRRGGRTIAESAESAVVFGMPERLINQGAADRVLPADRIAKQLVDWLS
NT seq
1050 nt
NT seq
+upstream
nt +downstream
nt
gtgacgaagcttctcatcgtcgatgactcggcgctgatgcggcgcaagctatccagtctg
ttcgagcaggccgggggattcgacatccgcctggcgcgcaatggcagggaagccgtggag
gaaaaccgcgttttccagccggacgtgatgacgctcgacatcaacatgccggagatggac
gggctgaccgcgctctcgttggtgatggccgagcgtccgacgccggtggtcatggtgtcc
tcgttgacggtgaaaagcgcgttggccaccttcgaggcgctggcgctgggcgccgtggac
tacgtggccaagcccgacggcaccatttcgctgcatctggcgcggatcgaggccgagcta
ttggccaaggtccggcacgccgcgcaggcaaggctgcgcccggcgccgccggtgcgtgcg
gcgccggtgcgcgagcgggccccgctgcgcttggcgccggctgccgtgccgagccatgaa
accggcctggtgctgatcggcgtgtcaaccggcgggccgcgcgcgctggaggatatcctg
ccgcagcttcccgccagtttcccgtggccggtgctgatcgcccagcatatgccggcggcc
ttcaccagcctgtttgcacaacggctggaccggctctgtgcgttgcaggttcaggaggtg
accgaaccgatggcgctggcgcccggcaaaatctatgtggctcgcggcggcggcgatgtg
gtggtcagcaagcgccgcgatcaacgcgtggcgctgccgcagcccgagcacgccgagcac
ttgtggcatccctcggtggaattgctggggcgctcggcgctgcaacactacccggcgcaa
gaattgatcggggtgatgctgaccggcatggggcacgacggggcccaggcgttcgccgag
atccatcggcgcggcggacgcacgatcgccgagtcggcggaatcggcggtcgttttcggc
atgcccgagcggctcatcaaccaaggcgcggccgaccgggtgctgccggccgatcggatc
gcaaagcaactcgtcgattggctttcctga
DBGET
integrated database retrieval system