Bordetella genomosp. 13: CAL15_06120 Help Entry CAL15_06120       CDS       T05441                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism bgm  Bordetella genomosp. 13 Pathway bgm00261   Monobactam biosynthesis bgm01100   Metabolic pathways bgm01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bgm00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     CAL15_06120  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bgm01008]     CAL15_06120 Polyketide biosynthesis proteins [BR:bgm01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     CAL15_06120 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ARP93994 UniProt:  A0A1W6ZAY3 LinkDB All DBs Position 1338007..1338228 Genome browser AA seq 73 aa AA seqDB search MSFDRDDITFHVVINDEDQYSIWPDFKPVPTGWRATDFSGDKAACLAHIEALWTDMRPAS LRRFMDDGESVPA NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgagtttcgaccgggacgacatcacttttcacgtggtgatcaacgacgaagaccaatac tccatctggcccgacttcaaaccggtgccgacagggtggcgagcgaccgatttcagcggt gacaaggctgcctgcctggcgcatatcgaagcactgtggaccgacatgcgtcccgccagc ctgcgccgcttcatggacgacggcgaatcggtccccgcctga

DBGET integrated database retrieval system