Bordetella genomosp. 13: CAL15_16760 Help Entry CAL15_16760       CDS       T05441                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bgm  Bordetella genomosp. 13 Pathway bgm01100   Metabolic pathways bgm01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bgm00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CAL15_16760    00074 Mycolic acid biosynthesis     CAL15_16760   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CAL15_16760 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 DUF1896 HLH Ribosomal_L50 EutQ DUF1493 Motif Other DBs NCBI-ProteinID:  ARP95883 UniProt:  A0A1W6ZER6 LinkDB All DBs Position complement(3747970..3748209) Genome browser AA seq 79 aa AA seqDB search MESIEQRVKKIVAEQLGVNEAEIKNESSFLDDLGADSLDMVELVMALEDEFETEIPDEEA EKITTVQQAIDYINSHGKQ NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggaaagcatcgaacagcgcgtcaagaagatcgtcgctgaacaacttggcgtgaacgaa gccgagatcaagaacgagtcctccttccttgacgacctcggtgccgattcgctcgacatg gtcgaactggtcatggcgctcgaagatgaattcgaaaccgagatccccgacgaagaggcg gagaagatcaccaccgtgcaacaggcgatcgactacatcaactcgcacggcaagcagtaa

DBGET integrated database retrieval system