Burkholderia gladioli ATCC 10248: BM43_5436 Help Entry BM43_5436         CDS       T03826                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism bgo  Burkholderia gladioli ATCC 10248 Brite KEGG Orthology (KO) [BR:bgo00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bgo03036]     BM43_5436    03400 DNA repair and recombination proteins [BR:bgo03400]     BM43_5436 Chromosome and associated proteins [BR:bgo03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     BM43_5436 DNA repair and recombination proteins [BR:bgo03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       BM43_5436 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Mitofilin Spore_III_AB DUF4763 Motif Other DBs NCBI-ProteinID:  AJW95337 UniProt:  A0AAP2JDV0 LinkDB All DBs Position 2:1690540..1690848 Genome browser AA seq 102 aa AA seqDB search MNNPTILQLQRQLGQLNRQVQEAKLREKRARLEQIANDVREFDISELELLRAGGFLKARR KKVRPKYYNPATGQTWSGRGKRPRWLVGRDLDEFLIRGATRA NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atgaacaacccgacgatcctccagttgcagcggcagctcggccaactcaatcggcaggta caggaggccaagctgcgcgagaaacgcgcccggctcgaacagatcgcgaacgacgtcagg gaattcgacatcagcgaactcgaactgctgcgcgccggtgggttcctcaaggcgcgccgc aagaaggtgcggcccaaatactacaacccggccaccgggcagacctggtcgggccggggc aagcggccgcgctggctggtgggccgcgatctcgacgagtttctgatccggggcgcgacg cgggcttga

DBGET integrated database retrieval system