KEGG   Burkholderia gladioli ATCC 10248: BM43_6996
Entry
BM43_6996         CDS       T03826                                 
Name
(GenBank) putative secretion-associated protein
  KO
K03220  type III secretion protein D
Organism
bgo  Burkholderia gladioli ATCC 10248
Brite
KEGG Orthology (KO) [BR:bgo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bgo02044]
    BM43_6996
Secretion system [BR:bgo02044]
 Type III secretion system
  Type III secretion core apparatus
   BM43_6996
SSDB
Motif
Pfam: Yop-YscD_cpl
Other DBs
NCBI-ProteinID: AJW94539
UniProt: A0AAW3F2V1
LinkDB
Position
2:complement(3573270..3574676)
AA seq 468 aa
MKLLRILTGTHAGAQLQLAPGAHRIGTDDAADIRLTDWRGADLWLTVDESGVVSAQAVAS
ANAGAAAGNPTSGPLETILLIDFVPMQFDGTILCVGDETGVWPSDYELLQTLLAKPVPKA
SPLRRRYLGIAAACFGVGAVIVTVSVLSTVQMSRAALPPNADDNARRVTEALAAARIDGL
NAHAVGDTVVVTGMLASSADDSAVRQLLRRLTITQVAPQYDVAPQVARSIEDSLGVPGAR
VQYGGGGRFVIKGSVGNKMALDAAIARVRADLDPNVKDIVADVSESASNATSTDATAYSE
MISADGVQYAQTPDGVKHIYASDPQDASAADAAAAADNAANAAANGAADSGVTGANGTVS
SNANTGVSAPAKVAATGTAASAQATPAAGKPARAGASRKDAAAKAANAPGAPAPRNTADE
FVPLPSASAELPRAARTHAPMPASATRPAALAQRAEPPSRQPAPPIAG
NT seq 1407 nt   +upstreamnt  +downstreamnt
atgaaactgctgcggattctgaccggcacccacgcaggcgcgcaattgcagctcgcgccc
ggcgcgcaccgcatcggcacggacgacgcggccgacatacgcctgacggactggcgcggg
gcggatctgtggctgacggtggacgaatcgggcgtggtgtcggcgcaggcggtggcctcg
gccaacgcgggcgcggcggccggcaacccgaccagcggcccgctcgagaccatcctgctg
atcgacttcgtgccgatgcagttcgacggcacgatcctctgcgttggcgacgaaaccggc
gtctggccgtcggactacgagctgctgcagacgctgctggccaagccggtgccgaaggcc
tcgccgctgcgccgccgctacctcggcatcgcggcggcctgcttcggcgtgggcgcggtg
atcgtgacggtctcggtgctctcgacggtgcagatgagccgcgcggccctgccgccgaac
gccgacgacaacgcgcgccgcgtcacggaagcgctcgcggcggcccgcatcgacggcctg
aacgcgcacgcggtgggcgacacggtggtggtgacgggcatgctggccagctcggccgac
gattcggcggtgcgccagttgctgcgccgcctgacgatcacccaggtcgcgccgcaatac
gacgtcgcgccccaggtggcgcgcagcatcgaggattcgctcggcgtgcccggcgcgcgc
gtgcagtacggcggcggcgggcgcttcgtgatcaagggctcggtcggcaacaagatggcg
ctcgacgcggcgatcgcgcgcgtgcgcgccgatctcgacccgaacgtgaaggacatcgtc
gccgacgtctccgaatcggccagcaacgccacctcgacggacgcgacggcctattcggaa
atgatctcggccgacggcgtgcagtacgcgcagacgcccgacggcgtgaagcacatctac
gcctcggatccgcaggacgcctcggcagccgacgcggcggcggcagccgacaacgccgcc
aatgccgccgcgaacggcgcggccgacagcggcgtgacgggcgcgaacggcaccgtcagc
agcaacgcgaacaccggcgtcagcgccccggccaaggtcgcggccaccggcacggcagcc
agcgcgcaggccacgcccgccgccggcaagccggcccgggccggcgcctcgcgcaaggac
gcggccgccaaggcggccaacgccccgggcgccccggccccgcgcaacacggccgacgaa
ttcgtgccgctgccctcggcctcggccgagctgccgcgcgcggcccgaacccatgcgccg
atgcccgcatcggccacccgccccgccgcgctcgcgcagcgggccgaaccaccgtcccgg
cagccggctccgccgatcgcgggctga

DBGET integrated database retrieval system