Burkholderia gladioli ATCC 10248: BM43_7408 Help Entry BM43_7408         CDS       T03826                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism bgo  Burkholderia gladioli ATCC 10248 Brite KEGG Orthology (KO) [BR:bgo00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bgo03036]     BM43_7408    03400 DNA repair and recombination proteins [BR:bgo03400]     BM43_7408 Chromosome and associated proteins [BR:bgo03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     BM43_7408 DNA repair and recombination proteins [BR:bgo03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       BM43_7408 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS ERM_C Motif Other DBs NCBI-ProteinID:  AJW93758 UniProt:  A0AAW3FAT9 LinkDB All DBs Position p1:96480..96809 Genome browser AA seq 109 aa AA seqDB search MTSKITELQSQLRDINIQLADARVEEKRALLAAVKEHAQSLGITQDELLIAAGFKKPKHR RAPAKYYDPSSGNKWSGRGPKPKWLQDKNLDDYLIDQNRPEPQAWWPGE NT seq 330 nt NT seq  +upstreamnt  +downstreamnt gtgacatcgaaaatcaccgaattgcaatctcagctgcgcgacatcaatatccaactggcc gatgcaagagtcgaggaaaagcgtgccctccttgctgcggtaaaggagcacgcgcagtcg ctaggaattacgcaggacgagctgttaatcgcagctgggttcaagaagccgaaacaccga cgcgcgccggcgaaatactatgacccgagcagcggtaataagtggtcaggacggggaccg aagccgaagtggctgcaagataaaaatctcgacgattacctcatcgaccagaatcgacct gagcctcaggcgtggtggccaggcgaatga

DBGET integrated database retrieval system