Brevundimonas goettingensis: IFJ75_08885 Help Entry IFJ75_08885       CDS       T07668                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bgoe  Brevundimonas goettingensis Pathway bgoe01100   Metabolic pathways bgoe01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bgoe00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     IFJ75_08885    00074 Mycolic acid biosynthesis     IFJ75_08885   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     IFJ75_08885 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF5783 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  QTC92937 UniProt:  A0A975GWS9 LinkDB All DBs Position complement(1792291..1792530) Genome browser AA seq 79 aa AA seqDB search MSDTLERVRKIVIDHLDADPDKVTEKASFIDDLGADSLDNVELVMAFEEEFDIEIPDDAA EHIQTVGDAVKFISEKTAG NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgtccgacaccctggaacgcgtccgcaagatcgtcatcgaccacctggacgccgatccg gacaaggtcaccgaaaaggccagcttcatcgacgacctgggcgccgactcgctcgacaac gtcgagctggtcatggccttcgaagaagaattcgacatcgagatcccggatgacgccgcc gagcacatccagaccgtcggcgacgccgtgaagttcatctcggaaaagaccgccggctaa

DBGET integrated database retrieval system