Brevundimonas goettingensis: IFJ75_12665 Help Entry IFJ75_12665       CDS       T07668                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism bgoe  Brevundimonas goettingensis Brite KEGG Orthology (KO) [BR:bgoe00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:bgoe03032]     IFJ75_12665    03036 Chromosome and associated proteins [BR:bgoe03036]     IFJ75_12665    03400 DNA repair and recombination proteins [BR:bgoe03400]     IFJ75_12665 DNA replication proteins [BR:bgoe03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     IFJ75_12665 Chromosome and associated proteins [BR:bgoe03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     IFJ75_12665 DNA repair and recombination proteins [BR:bgoe03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       IFJ75_12665 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 Motif Other DBs NCBI-ProteinID:  QTC90133 UniProt:  A0A975BYR0 LinkDB All DBs Position 2614679..2614957 Genome browser AA seq 92 aa AA seqDB search MTTQAELIAAVAKDAGVSQADAGRVLEAIVKNIHSSLTAGGDVRISNLGVFDTAARAERE GRNPATGATIKIAASKAVRFRVSKPLKDAVNK NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaccactcaagctgaactgatcgccgctgtcgccaaggacgccggtgtttcgcaggcc gacgccggccgcgtgctggaagcgatcgtcaagaacatccattcgtcgctgaccgccggt ggcgacgtccgcatctcgaacctgggcgtcttcgacaccgccgctcgcgccgagcgcgaa ggccgcaacccggccacgggcgcgaccatcaagatcgccgcctccaaggccgtccgcttc cgggtctccaagcccctgaaggacgcggtcaacaagtaa

DBGET integrated database retrieval system