Bythopirellula goksoeyrii: Pr1d_22990 Help Entry Pr1d_22990        CDS       T09914                                  Symbol acpP_1 Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism bgok  Bythopirellula goksoeyrii Pathway bgok01100   Metabolic pathways bgok01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bgok00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Pr1d_22990 (acpP_1)    00074 Mycolic acid biosynthesis     Pr1d_22990 (acpP_1)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Pr1d_22990 (acpP_1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QEG35009 UniProt:  A0A5B9QB79 LinkDB All DBs Position complement(2786311..2786574) Genome browser AA seq 87 aa AA seqDB search MNAEEIREEVLDILENIAPDEDLSDLDDSKNFREQLELDSMDFLDIVMELRKRHRIQIPE DDYLNLASMDSTVTYLKPILKDVEKAK NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgaacgcagaagaaatcagagaagaagtcctcgatattctcgagaacattgccccagac gaagacttgtcggatctcgacgattcgaaaaacttccgcgagcaactagaactcgacagc atggattttctagatatcgtgatggaactccgcaagcgccaccgcatccaaatccccgag gacgactacctcaatctggccagcatggattccaccgtcacctatctcaagcccattttg aaggacgtagaaaaagccaaatga

DBGET integrated database retrieval system