KEGG   Bythopirellula goksoeyrii: Pr1d_40510
Entry
Pr1d_40510        CDS       T09914                                 
Symbol
coaD
Name
(GenBank) Phosphopantetheine adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
bgok  Bythopirellula goksoeyrii
Pathway
bgok00770  Pantothenate and CoA biosynthesis
bgok01100  Metabolic pathways
bgok01240  Biosynthesis of cofactors
Module
bgok_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:bgok00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Pr1d_40510 (coaD)
Enzymes [BR:bgok01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     Pr1d_40510 (coaD)
SSDB
Motif
Pfam: CTP_transf_like Citrate_ly_lig
Other DBs
NCBI-ProteinID: QEG36715
UniProt: A0A5B9QGE9
LinkDB
Position
4860744..4861235
AA seq 163 aa
MSSRRAVYTGSFDPISLGHLNVIERSSRLVDELIVGVGINIEKQSLFTEKERVELLSRVT
KHLPNVEVKTFAGLAVQFVRDCDARVIIRGVRSLTDMETEFTMTLANRKLDPGVETVFLM
ADDEFSHVSSSLIKQITPLAGDEELARFVPREIVADLREKLSG
NT seq 492 nt   +upstreamnt  +downstreamnt
atgtcttctcgtcgcgccgtttacactggttcgttcgatcccatttcgctggggcatctc
aatgtcatcgagcggagcagccgacttgttgacgagttgatcgtcggcgtgggcatcaat
atcgagaagcagtcgctcttcacggagaaagaacgggtcgagttgctctcacgggttacc
aagcatctgccgaatgtcgaagtaaaaacctttgctgggctggccgtgcaattcgtccga
gactgcgatgcgagggtgattatccgtggcgtgcgatcactcaccgacatggagacggaa
ttcaccatgacactggccaatcgcaaactcgatccaggtgtcgagacggtgttcctgatg
gccgacgatgagttttcgcacgtttcgagtagtctgatcaaacaaatcacccccctagcc
ggcgacgaggagttggcacgcttcgtgccaagggaaattgttgctgatctgcgagagaaa
ctctccggctga

DBGET integrated database retrieval system