Bradyrhizobium guangdongense: X265_17030 Help Entry X265_17030        CDS       T05902                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bgq  Bradyrhizobium guangdongense Pathway bgq00998   Biosynthesis of various antibiotics bgq01100   Metabolic pathways bgq01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bgq00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     X265_17030    00074 Mycolic acid biosynthesis     X265_17030   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     X265_17030 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  QAU39177 LinkDB All DBs Position 3559445..3559684 Genome browser AA seq 79 aa AA seqDB search MSDIGERVKKIVVEHLGVEPEKVVDAASFIDDLGADSLDTVELVMAFEEEFGCEIPDDAA ETILTVGDATKFLEKNAKS NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagtgacattggcgagcgggttaagaagatcgtggtcgaacaccttggtgttgaaccc gagaaggttgtcgacgctgcgagcttcatcgacgacctcggcgccgacagtctggacacc gtcgagctggtgatggcgttcgaagaagaattcgggtgcgaaattccggacgacgccgcg gagaccattctcaccgtcggcgacgccaccaagtttctcgagaagaacgcgaagagctaa

DBGET integrated database retrieval system