Bartonella grahamii: Bgr_06190 Help Entry Bgr_06190         CDS       T00922                                  Symbol acpP1 Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bgr  Bartonella grahamii Pathway bgr01100   Metabolic pathways bgr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bgr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Bgr_06190 (acpP1)    00074 Mycolic acid biosynthesis     Bgr_06190 (acpP1)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Bgr_06190 (acpP1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 Delta_lysin Motif Other DBs NCBI-ProteinID:  ACS50934 UniProt:  C6ACM2 LinkDB All DBs Position 746459..746695 Genome browser AA seq 78 aa AA seqDB search MSDTVERVKKIIVEHLGVNADKVVENASFIDDLGADSLDTVELVMAFEEEFGVEIPDEAA ETIFTVGDAVKFIDKASA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagtgatacagtagagcgcgttaagaaaattattgtggaacatcttggggttaatgct gataaagttgtagaaaatgcaagctttatcgatgatctaggggctgatagccttgatacg gttgaactcgttatggcttttgaagaagagtttggggtagaaattccagatgaagctgct gaaacgattttcacagttggtgatgcagtcaagttcattgataaagcttctgcatga

DBGET integrated database retrieval system