Bordetella genomosp. 8: CAL12_10195 Help Entry CAL12_10195       CDS       T09515                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bgv  Bordetella genomosp. 8 Pathway bgv01100   Metabolic pathways bgv01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bgv00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CAL12_10195    00074 Mycolic acid biosynthesis     CAL12_10195   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CAL12_10195 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ARP81173 UniProt:  A0A1W6YKV5 LinkDB All DBs Position complement(2209049..2209321) Genome browser AA seq 90 aa AA seqDB search MEQLESEIKRLIIESLGLEDIAPEDIDNDAELFGDGLGLDSVDALELGLALQKRYGIAID PETRNMRDHFATVANLSKFVSAQRAPEQRS NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atggaacagctggaaagtgaaatcaagcgactgatcatcgagtcgctgggattggaagat atcgcgcccgaggatatcgacaacgatgccgaactgttcggggatgggctggggctggac tccgtcgatgcccttgaactggggctggcgctgcaaaagcgctacgggattgccatcgat cccgaaacgcgtaatatgcgcgaccatttcgccaccgtggccaatttgagcaaattcgta tccgcccagcgggcgcctgagcaacggagctag

DBGET integrated database retrieval system