Bacillus glycinifermentans: BGLY_0027 Help Entry BGLY_0027         CDS       T04537                                  Symbol bofA Name (GenBank) BofA   KO K06317   inhibitor of the pro-sigma K processing machinery Organism bgy  Bacillus glycinifermentans Brite KEGG Orthology (KO) [BR:bgy00001]  09190 Not Included in Pathway or Brite   09193 Unclassified: signaling and cellular processes    99978 Cell growth     BGLY_0027 (bofA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  BofA TssN Motif Other DBs NCBI-ProteinID:  SCA83850 UniProt:  A0A0J6E233 LinkDB All DBs Position 1:33914..34180 Genome browser AA seq 88 aa AA seqDB search MGSVIIIGAIVALVALLFFSGASFKPLKWAGTIAVRFIIGALLLFCVNLFGESMGIHLPI NVITTGISGLLGIPGVAALIVIKQFIII NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgggatctgttattatcattggggcaattgtggcgttggttgccctgttgtttttttca ggagcctcctttaaaccgttaaaatgggctggtacaattgccgttcgatttatcatcggg gcgctgttattattctgtgtgaatctgtttggcgagagcatgggaattcacttgccgatt aatgttattacgacaggaatcagcgggctgttgggtattccgggagtggcggcacttatt gtgattaagcagtttattataatttaa

DBGET integrated database retrieval system