KEGG   Bacillus glycinifermentans: BGLY_1245
Entry
BGLY_1245         CDS       T04537                                 
Symbol
med
Name
(GenBank) transcriptional activator protein Med
  KO
K05519  transcriptional activator of comK gene
Organism
bgy  Bacillus glycinifermentans
Brite
KEGG Orthology (KO) [BR:bgy00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bgy03000]
    BGLY_1245 (med)
Transcription factors [BR:bgy03000]
 Prokaryotic type
  Other transcription factors
   Others
    BGLY_1245 (med)
SSDB
Motif
Pfam: Bmp Peripla_BP_4 YvfG
Other DBs
NCBI-ProteinID: SCA85068
UniProt: A0A1C3SBI3
LinkDB
Position
1:1285689..1286648
AA seq 319 aa
MVYRLVVIFLMLLAMCGCGQASLNGKIEKVGLLVPDTISDQVWGTKGYKGLLRIQSVYGV
DVYYKEGIDNEAAIKMAVDDFQKKGVNLIFGHGSEYEKVFNRISGDYPGIHFVLVNSKAE
HKNVTSIDFDGRAMGFFGGMTAAHQSKSGKLGILATHSWQPEVKGFIEGAKYVNPDISVM
TEYVGQWDDSEKAVQKYEKMKKAGADVVYPAGDGYNVPVIEQIKKDGLYAIGYVSDQSEL
GENVVLTSTIQHVDEAYELIAGEFNKGTLKGGRRVFDIQDGVIEMGEFSPVVDQAFQKKI
KGLIEQYKKTGKLPDENVR
NT seq 960 nt   +upstreamnt  +downstreamnt
atggtatacaggcttgtcgtgatttttttgatgctccttgcgatgtgcggctgcggacaa
gcatcgctgaacgggaagattgaaaaggtcgggttgcttgtccctgatacaataagcgat
caagtatggggaaccaaaggatataaaggactattaagaatacagtctgtctacggtgtc
gatgtctattataaagaaggaatcgataatgaagcggctatcaaaatggccgtagacgat
tttcagaaaaaaggcgtcaatttaattttcgggcatggaagcgaatatgaaaaagtgttt
aatcgtataagcggagactatcccggcattcatttcgtcttggttaacagcaaagccgag
cataaaaatgtgaccagcatcgactttgacggaagggcgatgggctttttcggcggcatg
accgccgcacaccaatcaaagtcaggaaaactcggcatacttgcaacgcatagctggcag
cctgaagtcaaagggtttatcgaaggcgccaaatatgtgaatccagacatttcggtcatg
acagagtatgtgggacagtgggatgactccgaaaaggccgttcaaaagtacgaaaaaatg
aaaaaagcgggcgccgatgttgtatatccggcgggagatgggtataatgtccctgtcatt
gaacaaatcaaaaaagacggactatacgccataggctatgtaagcgaccagtcggagctg
ggggagaacgtcgtcctgacgagcaccatccagcatgttgacgaagcttatgaactgatc
gccggcgaattcaataaaggaacgctcaagggaggccggcgggtctttgacattcaggac
ggcgtcatcgaaatgggcgaattcagcccggttgtcgatcaagccttccagaaaaaaatc
aaaggacttattgaacaatataaaaaaacgggaaaactgccggatgaaaacgtgaggtga

DBGET integrated database retrieval system