Bradyrhizobium guangzhouense: XH91_20345 Help Entry XH91_20345        CDS       T06161                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bgz  Bradyrhizobium guangzhouense Pathway bgz00998   Biosynthesis of various antibiotics bgz01100   Metabolic pathways bgz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bgz00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     XH91_20345    00074 Mycolic acid biosynthesis     XH91_20345   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     XH91_20345 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 Motif Other DBs NCBI-ProteinID:  QAU47465 UniProt:  A0AAE5X2U5 LinkDB All DBs Position complement(4204144..4204383) Genome browser AA seq 79 aa AA seqDB search MSDIGERVKKIVVEHLGVEPEKVVDAASFIDDLGADSLDTVELVMAFEEEFGCEIPDDAA ETILTVGDATKFLEKNAKS NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagtgacattggcgagcgggttaagaagatcgtggtcgaacaccttggtgttgaaccc gagaaggttgtcgacgcagcgagcttcatcgatgacctcggcgccgacagtctggacacc gtcgagctggtgatggcgttcgaagaagaattcggttgcgagattccggacgacgccgct gagacgattctcaccgtcggcgacgccacgaagtttctcgagaagaacgcgaagagctaa

DBGET integrated database retrieval system