KEGG   Halalkalibacterium halodurans: BH1801
Entry
BH1801            CDS       T00039                                 
Name
(GenBank) positive regulator of comK
  KO
K05519  transcriptional activator of comK gene
Organism
bha  Halalkalibacterium halodurans
Brite
KEGG Orthology (KO) [BR:bha00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bha03000]
    BH1801
Transcription factors [BR:bha03000]
 Prokaryotic type
  Other transcription factors
   Others
    BH1801
SSDB
Motif
Pfam: Bmp Peripla_BP_4 DUF5645
Other DBs
NCBI-ProteinID: BAB05520
UniProt: Q9KBX3
LinkDB
Position
1874417..1875343
AA seq 308 aa
MILCYQSVKIVLSPDTEPTDRVIMSIFTSDKLVDQSWGSLAYLAQLHVEKKFPVDIELYS
EVDTIEKMEESLHASIDRKTELIIGHGREFSDIFTKVAPSYPTVRFVTIHGSATYENQTV
YTFEKGKIELIAALAATMKSKTRKVALIDAYDGREDEPYFERGLEKYANDIEFFYYVVNS
RHDGKQAKAVMDKLIKEGVDVVYSRGNAFNRDVIHYAKQHDIYVIGFLDDQSYLGEEHVL
TSVLNDVTQAYVKIIEDYFNEEEPFPNGIVILSGKDGVFRLAPFGKMFTEEEKKRLQEEL
DRYYRGEL
NT seq 927 nt   +upstreamnt  +downstreamnt
atgattctttgctatcaatcagtaaaaattgtgttaagtccagatactgaaccaactgac
cgagtcataatgagtatttttacgtcagataaactggtggatcagagttggggcagctta
gcctatttggctcagctccatgtggagaagaagtttccggtcgatattgaactttatagt
gaagtcgatacaatagagaaaatggaagaatccttgcatgcctccatagatcgaaaaacg
gaactgattattgggcacgggcgagagttttctgacatttttacaaaagttgcaccaagc
tatccaactgttcgatttgttacgattcatggaagcgcaacttatgagaatcaaacggtc
tatacgtttgaaaaggggaaaattgaactgattgcagcccttgccgctacgatgaaatcg
aaaacgagaaaagtggcactcatcgatgcttatgatggacgagaagatgagccttatttt
gaacgaggccttgaaaaatatgctaatgatatcgagtttttttattacgttgtaaacagc
cgccatgatggaaagcaggcgaaagcagtgatggataaattaataaaagaaggagttgac
gtcgtctattcccgtggcaacgcgttcaaccgagacgtgattcattacgcgaaacaacat
gacatctatgtcatcggctttcttgatgaccagtcgtaccttggtgaggagcacgtgctg
acaagtgtattgaacgatgttactcaggcctatgttaaaattatagaagattattttaac
gaggaagagccttttccaaatgggatcgttatcctctcgggaaaagacggtgtttttcgc
ttggcgcctttcgggaagatgtttacagaggaagaaaaaaaacgtttacaggaagagttg
gatcgctactatcgtggtgaattatag

DBGET integrated database retrieval system