Halalkalibacterium halodurans: BH1846 Help Entry BH1846            CDS       T00039                                  Name (GenBank) acyl-carrier protein   KO K02078   acyl carrier protein Organism bha  Halalkalibacterium halodurans Pathway bha01100   Metabolic pathways bha01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bha00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BH1846    00074 Mycolic acid biosynthesis     BH1846   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BH1846 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Motif Other DBs NCBI-ProteinID:  BAB05565 UniProt:  Q9KBS8 LinkDB All DBs Position 1923947..1924186 Genome browser AA seq 79 aa AA seqDB search MAVVIKEAIFTIFAEVLELEENEITFDFSKEEHSEWDSVNSLRLFTNIEEELDVRLDMNA FMNAATIREVVALVEAQQA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggcagtagtaataaaagaagcaattttcaccatctttgcagaggttcttgagcttgaa gaaaatgaaataacgtttgatttttctaaagaggaacattcggaatgggattctgtaaat tcattacgcctgttcacaaatattgaagaggaattagatgtaagactcgatatgaatgcg ttcatgaatgccgcaacaattcgagaggttgttgcattagtggaggcacaacaagcatga

DBGET integrated database retrieval system