Halalkalibacterium halodurans: BH2365 Help Entry BH2365            CDS       T00039                                  Name (GenBank) host factor-1 protein   KO K03666   host factor-I protein Organism bha  Halalkalibacterium halodurans Pathway bha02024   Quorum sensing bha03018   RNA degradation Brite KEGG Orthology (KO) [BR:bha00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     BH2365  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     BH2365  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:bha03019]     BH2365    03036 Chromosome and associated proteins [BR:bha03036]     BH2365 Messenger RNA biogenesis [BR:bha03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      BH2365 Chromosome and associated proteins [BR:bha03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     BH2365 SSDB OrthologParalogGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  BAB06084 UniProt:  Q9KAC4 LinkDB All DBs Position complement(2482052..2482288) Genome browser AA seq 78 aa AA seqDB search MKSSVNIQDHFLNQLRKENIPVTVFLLNGFQLRGLVKGFDNFTVILETEGKQQLVYKHAI STFAPQRNVQMKTENEPS NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgaaatcatcggtaaatatccaagatcactttttaaaccagctacgcaaagaaaacata cctgtcaccgttttcttgctcaatggttttcagctccgtggactggtgaaaggttttgat aacttcactgtgatccttgagaccgaaggaaagcaacaacttgtctataagcatgccatt tccacgttcgcaccgcagcgcaatgtgcaaatgaaaaccgaaaatgaaccatcgtga

DBGET integrated database retrieval system