Breznakiella homolactica: JFL75_04580 Help Entry JFL75_04580       CDS       T07248                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism bhc  Breznakiella homolactica Pathway bhc00020   Citrate cycle (TCA cycle) bhc00720   Other carbon fixation pathways bhc01100   Metabolic pathways bhc01110   Biosynthesis of secondary metabolites bhc01120   Microbial metabolism in diverse environments bhc01200   Carbon metabolism bhc01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:bhc00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     JFL75_04580   09102 Energy metabolism    00720 Other carbon fixation pathways     JFL75_04580 Enzymes [BR:bhc01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      JFL75_04580 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_2 Fer4_10 Fer4_7 Fer4_21 Fer4_6 Fer4_9 Fer4_15 Fer4_16 Fer4_4 LdpA_Fe-S-bd Fer4_3 Fer4_13 Fer4_17 Fer4_8 Fer4_22 Fer4_18 Motif Other DBs NCBI-ProteinID:  QQO10203 UniProt:  A0A7T8BCF5 LinkDB All DBs Position complement(3336035..3336265) Genome browser AA seq 76 aa AA seqDB search MARRGKVIIDRELCKGCYLCVASCPVKVLAEDTEPNSTGTYPAKAVHLEKCIACGNCYQV CPDVCIAVYELEGDES NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggccagacgaggaaaagtaatcatcgaccgggaactgtgcaaaggctgctacctttgc gtcgcgtcctgtccggtgaaggttttagcggaggataccgaacccaactcaaccggaacc tacccggcaaaggcagttcatctggaaaaatgcattgcctgcggcaattgctaccaggta tgccccgatgtatgcattgcggtgtatgaattggaaggagatgaatcatga

DBGET integrated database retrieval system